Bacterial taxon 1308539
Locus VK055_3648
Protein AIK82203.1
hypothetical protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 127 aa, Gene n/a, UniProt n/a
>AIK82203.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hypothetical protein
MKLTIIRLQHFSDQDRIDLGKIWPSQDLSTLTLDENHRLYAARFNERLLGAVRVTLRGVEGELSDLCVREVTRRRGVGQYLVEETLRDNPAINSWRVADHGVEDRGVMAAFMQALGFSAQQNGWEKH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.95 | 8.4e-12 | ●○○○○ -0.3 | -0.3035923953650932 | 26060277 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)