Bacterial taxon 1308539
Locus VK055_4770
Protein AIK83298.1
hypothetical protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 115 aa, Gene n/a, UniProt n/a
>AIK83298.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hypothetical protein
MFRSLILAAVLLAAGPLVANAGEITLLPSVKLQIGDRDNYGNYWDGGSWRDRDYWRRHYEWRDNRWHRHDKGWYKGRDKAWERGYRAGWNDRDDHRGGWGRGPGGRGHGHGHGHH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.4 | 3.4e-7 | ○○○○○ 0.96 | 0.9563629247571442 | 26060277 |
Retrieved 1 of 1 entries in 17.4 ms
(Link to these results)