Bacterial taxon 1308539
Locus VK055_4797
Protein AIK83324.1
hypothetical protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 182 aa, Gene n/a, UniProt n/a
>AIK83324.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|hypothetical protein
MQQQHHYQQLIDLFDSCFAEEFNTRLIKGDDEPIYLPADDETPYHRIVFAHGFFASALHEISHWCVAGKARREQVDFGYWYCPDGRDAMTQSQFEDVEVKPQAFEWLFCVAAGFPFNVSCDNLEGDVEPDRIAFQRRVHARVMALLEQGIPERPARFIRALQHYYQTPPLTAEHFPWPEDLH
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -5.07 | 0.0077 | ●●●○○ -2.51 | -2.5091651195633915 | 26060277 |
Retrieved 1 of 1 entries in 29.8 ms
(Link to these results)