Bacterial taxon 1308539
Locus VK055_3140
Protein AIK81713.1
magnesium-dependent DNase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 263 aa, Gene n/a, UniProt n/a
>AIK81713.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|magnesium-dependent DNase
MFDIGVNLTSSQFSRDHDEVVARALAAGVNGMLLTGTNLAESQQAQKLASRYSGCWSTAGVHPHDGSSWTPAVAEAIYTLAGEPQVVAIGECGLDFNRNFSTPHEQEVAFSAQLALAAELSMPVFLHCRDAHDRFLTLLKPWLEKIPGAVLHCFTGSRSEVQECLDLGLFIGITGWVCDERRGLELRELLPAIPAERLLLETDAPYLLPRDLKPKPASRRNEPAYLPHILASVAAWRGEEAQWLEAQTDANVRALFGVDINGV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.27 | 1.4e-5 | ●●○○○ -1.01 | -1.0104083537358262 | 26060277 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)