Bacterial taxon 1308539
Locus VK055_2985
Protein AIK81570.1
molybdopterin oxidoreductase family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 139 aa, Gene n/a, UniProt n/a
>AIK81570.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|molybdopterin oxidoreductase family protein
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEAVSWDEALDYVATRLSAIKAKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.06 | 3.0e-6 | ●○○○○ -0.36 | -0.36309520242213206 | 26060277 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)