Bacterial taxon 1308539
Locus VK055_1970
Protein AIK80576.1
oligopeptide/dipeptide ABC transporter, ATP-binding, C-terminal domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 336 aa, Gene n/a, UniProt n/a
>AIK80576.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|oligopeptide/dipeptide ABC transporter, ATP-binding, C-terminal domain protein
MSDNAFVHVRDLRVVFRRDGQTINAVNGVSFEVQKGEVMALIGESGSGKSVTLRALMRLHPPGSSELSGTLQVGDDEVLTMSASQLRRYRGGRCAMIFQEPLLAFDPVYTVGQQIIEGLRRHEGLSRQAARDRALEALSQVRIPSPERRLDAYPHEMSGGMRQRAMIALALSCNPQLLLADEPTTALDATVQIQILILLREQQKQRGLSIVFVTHDIGAAVEIADRVAVMYAGRIVEEASMSEILRHPRHPYTQVLLGSRPKEGLKKGDALHCIPGAPPDLARLPPGCAFAERCPHRRPVCEQSLPPTESVAERHAVSCHRWRELAIDANAQALAV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.81 | <1e-323 | ○○○○○ 1.18 | 1.1783549103146378 | 26060277 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)