Bacterial taxon 1308539
Locus VK055_1209
Protein AIK79832.1
ompW, outer membrane protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 212 aa, Gene n/a, UniProt n/a
>AIK79832.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|ompW, outer membrane protein
MKKLAAAALILGTLSTGSVWAHEAGEFFIRAGTATVRPTEGSDNVLGSLGSFNVSNNTQLGLTFTYMATDNIGVELLAATPFRHKVGTGPTGTIATVHQLPPTLMAQWYFGDAQSKVRPYVGAGINYTTFFNEDFNDTGKAAGLSDLSLKDSWGAAGQVGLDYLINRDWLLNMSVWYMDIDTDVKFKAGGVDQKVSTRLDPWVFMFSAGYRF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.83 | <1e-323 | ○○○○○ 0.65 | 0.6512452350335982 | 26060277 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)