Bacterial taxon 1308539
Locus VK055_2865
Protein AIK81454.1
opacity-associated A N-terminal motif family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 224 aa, Gene n/a, UniProt n/a
>AIK81454.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|opacity-associated A N-terminal motif family protein
MPGRFELTSTLAKIWHAPDHFRLLDPLPPMHRRGIIAGFLLVIIGILLPSDDSQSPASTSREANLNLQSQSQPQAGGNQAVPLPPITNTPTVSDADQMAPVAPEPIQDEQPDQAQTQQPAATQPYQSSSQQSAPGIEQQWRTYRIESGKTLAQLFRDHGLPATDVYAMAQVEGADKPLSTLQSGQTVQIRQNASGVVTGLTIDTGNGQQVLFTRQSNGSFVRAR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.92 | 0.0017 | ●○○○○ -0.28 | -0.28277417096000057 | 26060277 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)