Bacterial taxon 1308539
Locus VK055_1936
Protein AIK80542.1
periplasmic binding and sugar binding domain of LacI family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 313 aa, Gene n/a, UniProt n/a
>AIK80542.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|periplasmic binding and sugar binding domain of LacI family protein
MKTTLIKSVLFASMMAASGSLFAADNGLIAIITPSHDNPFFKAEADGAAAKAKELGYSTLVASHDDDVNKQNQLIETAIARKAKAIILDNAGADATVGPLEKAKAAGVPAFLIDREINKTGVAVAQIVSNNYQGAQLGAEKFASLLNGKGKYVELLGRQSDTNASVRSQGYHDVLDDYPEMKMVAQQTANWSQTEAFTRMEAILQTNPDIVGVISGNDTMALGAEAALKAAGKNDVIVVGFDGSDYTRDSILKQGNIKATVLQPGWKQAQMAVEQADFFLKNGKAQKEEKQLMDCILIDSGNAKKLNMFNLSE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.01 | 1.3e-11 | ○○○○○ 0.75 | 0.7473425185976517 | 26060277 |
Retrieved 1 of 1 entries in 8.3 ms
(Link to these results)