Bacterial taxon 1308539
Locus VK055_1033
Protein AIK79656.1
phenylacetic acid degradation protein PaaD
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 129 aa, Gene n/a, UniProt n/a
>AIK79656.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|phenylacetic acid degradation protein PaaD
MYEKDTCARKMGIELIEMDDGFAQMSMTVSADMLNGHQTCHGGQLFTLADTAFAYACNSQGLAAVASAASIDFLRPAFAGDRLVATARVKQQGKLTGVYDIEIVNQQQKIVALFRGKSHRIGGTITGDV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 3.56 | 2.3e-12 | ○○○○○ 2.12 | 2.1189850765046776 | 26060277 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)