Bacterial taxon 1308539
Locus VK055_3861
Protein AIK82411.1
phosphocarrier, HPr family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 90 aa, Gene n/a, UniProt n/a
>AIK82411.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|phosphocarrier, HPr family protein
MTVKQTVEITNKLGMHARPAMKLFELMQNFDAEVLLRNDEGTEAEANSVIALLMLDSAKGRQIEVEASGPQEVEALAAVIALFNAGFDED
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.71 | 7.2e-13 | ●●○○○ -1.78 | -1.7835949481503512 | 26060277 |
Retrieved 1 of 1 entries in 11.5 ms
(Link to these results)