Bacterial taxon 1308539
Locus VK055_2967
Protein AIK81552.1
phosphonate C-P lyase system protein PhnG
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 150 aa, Gene n/a, UniProt n/a
>AIK81552.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|phosphonate C-P lyase system protein PhnG
MHFDTATRQRWMSVLAHSEPQDLLARMQSLQLAPEYELIRPPETGLVQLQARMGGIGDRFFAGDATLTRAAVRLADGTLGYSWILGRDRPHAERCAAIDALLQSPRHFHTLMETLITPLEALRSARIEARRAEVNASRVDFFTLVRGDNA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -6.54 | 0.00018 | ●●●●○ -3.3 | -3.2969548784275897 | 26060277 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)