Bacterial taxon 1308539
Locus VK055_2957
Protein AIK81542.1
plasmid stability family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 123 aa, Gene n/a, UniProt n/a
>AIK81542.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|plasmid stability family protein
MTLDRRKVLIYLRPDISASERFADAKIEAHHRGDRGDMSRTALLAGLALGEVDSRLPSMLAALLAEDTKPETLRKMLASFLEIQPASPAPAAAPAAAPAKAPEPPAPVSESVSARNLAGSLPD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.48 | 3.6e-5 | ●●○○○ -1.12 | -1.119226702113825 | 26060277 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)