Bacterial taxon 1308539
Locus VK055_2628
Protein AIK81222.1
PTS system mannose/fructose/sorbose IID component family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 279 aa, Gene n/a, UniProt n/a
>AIK81222.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|PTS system mannose/fructose/sorbose IID component family protein
MISEETLQPQAQEETRITPRDLRRVFWRSFQMEFSWNYERQMNLAFVYALIPVLKKLYPRREELAAALKRHLVFFNTTPHIVTLLLGITTAMEEKNSQQKNMDATAIDNVKASLMGPLAGLGDSFFWGTLRLIATGIGTSLALKGNILGPILFLLVFNVPHILVRWCFTRWGYVLGTGVLQRIQKSGMMESLTYGASIIGLMVVGAMTASMIDITIPLSFGAGEAKTQVQDIINDILPCMLPLVSFGIVYWLLGRKVKPLSIIGGMALVGILGSWIGLF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.97 | <1e-323 | ○○○○○ 0.73 | 0.7253997412692343 | 26060277 |
Retrieved 1 of 1 entries in 13.3 ms
(Link to these results)