Bacterial taxon 1308539
Locus VK055_2303
Protein AIK80907.1
PTS system sugar-specific permease component family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 420 aa, Gene n/a, UniProt n/a
>AIK80907.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|PTS system sugar-specific permease component family protein
MDIINSIISLGASVMMPVIFFIIALCFGVKIGTAFKAGMLVGIGFEGVGLVIGLLLTNLGPASQAMVERIGLQLTVVDTGWPTASTIGWGSPLMLPVVVGFIVINLAMLLLKLTKTVNIDIFNYWIFLIMGSVVYAGTGNYWLSVGITFAIFVLTLLAADLTAPYLQKNYNLKGISFPHLTCIAYVPFGIACNYIIDKIPLINKINFDPESINKKFGVFGEPLTLGFVLGLLLAFLAGYDVSAAVSLAIKVSAAMLLLPKMIEILVQGLLIVRDAAEAKLKAKFPGRDFYIGMDTALLIGEPSVLATGLLLIPMAVVLSIILPGNRVLPFVDLASLMFLLAMVTPFCKRNMFRMFITGTLIVTCILYVGTDISQEYTQAAVNSHIPVPEGMAEITNIVGGATTPVGWLAVKFGEFFSATH
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.48 | 7.2e-10 | ○○○○○ 1 | 1.0035098473922803 | 26060277 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)