Bacterial taxon 1308539
Locus VK055_1365
Protein AIK79988.1
purine nucleoside phosphoramidase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 118 aa, Gene n/a, UniProt n/a
>AIK79988.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|purine nucleoside phosphoramidase
MAEETIFSKIIRREIPSDIVYQDELVTAFRDISPQAPTHILIVPNVLIPTVNDVTAEHELALGRMMTVAAKIARDEGLADDGYRLIVNCNRHGGQEVYHIHMHLLGGRPLGPMLAHKG
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 2.85 | 0.012 | ○○○○○ 1.74 | 1.7357619617297264 | 26060277 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)