Bacterial taxon 1308539
Locus VK055_3050
Protein AIK81635.1
putative cheW domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 95 aa, Gene n/a, UniProt n/a
>AIK81635.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|putative cheW domain protein
MDTLRWLNDDEFPFLTTPFHPPQVYAPPAGCVISIAKTAVLRPGAQKKAPNFVASITKSRSGRHPPRREPISHPPISSPIKKPGGGGFACVMNAA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.82 | 2.3e-8 | ●●○○○ -1.31 | -1.3057150808847608 | 26060277 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)