Bacterial taxon 1308539
Locus VK055_1417
Protein AIK80038.1
putative membrane protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 237 aa, Gene n/a, UniProt n/a
>AIK80038.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|putative membrane protein
MSSSNSSSTFSVLSFVDGLWDLAKVAKLIYFTLCFDVLFFYLKGNGLFGIKLGKEFDLSLADLAGMIIALGIFSSIILEITTLCFNLLLIRIKYSNLLQSKDERIYQKSSTEVFMSELRDDALENGDDMSLKLYTEEQSKREKNYKEGRAAEIISFGTIFVFSIEWYLSASNGSSRMFIDWLWEQSKHSDPTTPHYLIGLLISSALLFYAVSVCWPKEDGHKIYYPKLAKKLRKKEH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -4.73 | 8.1e-7 | ●●●○○ -2.33 | -2.3266724892181645 | 26060277 |
Retrieved 1 of 1 entries in 29.5 ms
(Link to these results)