Bacterial taxon 1308539
Locus VK055_3862
Protein AIK82412.1
putative P-loop containing ATPase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 284 aa, Gene n/a, UniProt n/a
>AIK82412.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|putative P-loop containing ATPase
MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDLARSLADRNISAAVSIDVRNMPESPEIFEQAMQNLPECFSPQLLFLDADRNTLIRRYSDTRRLHPLSSKNLSLESAIDEESDLLEPLRSRADLIVDTSEMSVHELAEMLRTRLLGKRERELTMVFESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQTRSYLELWLPMLETNNRSYLTVAIGCTGGKHRSVYIAEQLADYFRSRGKNVQSRHRTLEKRKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -7.02 | 4.8e-7 | ●●●●○ -3.56 | -3.555556795286602 | 26060277 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)