Bacterial taxon 1308539   Locus VK055_3862   Protein AIK82412.1

putative P-loop containing ATPase

Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1

Length 284 aa, Gene n/a, UniProt n/a

>AIK82412.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|putative P-loop containing ATPase
MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPDLARSLADRNISAAVSIDVRNMPESPEIFEQAMQNLPECFSPQLLFLDADRNTLIRRYSDTRRLHPLSSKNLSLESAIDEESDLLEPLRSRADLIVDTSEMSVHELAEMLRTRLLGKRERELTMVFESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVAAFLDRHTEVHNFIYQTRSYLELWLPMLETNNRSYLTVAIGCTGGKHRSVYIAEQLADYFRSRGKNVQSRHRTLEKRKS

 

Protein visualisation unavailable   Find similar proteins   Download Table  
Host Tissue    Time Post Infection Transposon Insertion Site Raw Fitness Score    p-Value    Fitness z-Score Reference  
Mouse (Mus musculus C57BL/6)lung BTO:000076324 hnot available in this study-7.024.8e-7●●●●○ -3.56-3.55555679528660226060277
Retrieved 1 of 1 entries in 1.1 ms (Link to these results)