Bacterial taxon 1308539
Locus VK055_3631
Protein AIK82187.1
putative periplasmic protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 185 aa, Gene n/a, UniProt n/a
>AIK82187.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|putative periplasmic protein
MRNLVKYVGIGLLVMGLAACDNSDSKAPTVGAAAESNASGQAISLLDGKLSFTLPAGMADQSGKLGTQANNMHVYSDATGQKAVIVIVGDSTNEDLAVLAKRLEDQQRSRDPQLQVVSNKPLEIKGHTLQQLDSIISAKGQTAWSSVILGKVDDKLLTLQVTLPADNQQQAQTEAESIINTLTIQ
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.97 | <1e-323 | ●●○○○ -1.38 | -1.3830035752547913 | 26060277 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)