Bacterial taxon 1308539
Locus VK055_2356
Protein AIK80953.1
putative regulator in colanic acid synthesis; interacts with RcsB
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 118 aa, Gene n/a, UniProt n/a
>AIK80953.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|putative regulator in colanic acid synthesis; interacts with RcsB
MLSRSPVEPAQSTATPPVKSEPSKPRATRPVPVRIYTDASELVGKPFRDLGEVSGESCQASNQDSPPNIPTARKRLQINAARMKANAVLLHRCEVTSGTPGCYRQAVCLGSALNVSAQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.21 | <1e-323 | ●○○○○ -0.98 | -0.9794936966289591 | 26060277 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)