Bacterial taxon 1308539
Locus VK055_3598
Protein AIK82153.1
putative transcriptional regulator LYSR-type
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 299 aa, Gene n/a, UniProt n/a
>AIK82153.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|putative transcriptional regulator LYSR-type
MDKIHAMQLFIRVADLESFSRAAETLALPKGSVSRQIQALESHLGVRLLHRTTRRVQLTQDGMVYYERAKDLLSNLDELDGMFQHDPASISGRLRVDMPVGFAKKMVIPHLPTFLQQYPGIELELSSSDRLVDVIREGFDCVVRVGALKDSGLIARPLGKLTQINCASPDYLARFGYPQSLEDLADHALIHYASTLGVRPPGFEVMIDGAVRWVKTGGILTVNSTETYQAACIAGLGIIQVPRTGVREALRAGDLIEILPQYRAEPLPVSLIYPHRRNLSRRVNLFMEWLGGLMKAYVD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.88 | <1e-323 | ●○○○○ -0.26 | -0.26210461908465155 | 26060277 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)