Bacterial taxon 1308539
Locus VK055_2227
Protein AIK80832.1
pyrroline-5-carboxylate reductase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 269 aa, Gene n/a, UniProt n/a
>AIK80832.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|pyrroline-5-carboxylate reductase
MDKKIGFIGCGNMGKAILGGLIASGQVQPGQIWVYTPSPDKVAALRDQYGINAASSAQEVAQIADIVFGAVKPGIMTKVLGDIASSLNKESLVVSIAAGVTLEQLARALGHDRKIIRAMPNTPSLVNAGMTSVTPNALVSSEDVAEVLTIFRCFGQAEQIAEPMIHPVVGVSGSAPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLESGEHPGALKDMVCSPGGTTIEAVRVLEEKGFRSAVIEAITQCMEKSEKLSRS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.3 | 3.7e-6 | ●○○○○ -0.49 | -0.4877229250730404 | 26060277 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)