Bacterial taxon 1308539
Locus VK055_2146
Protein AIK80751.1
queuosine biosynthesis protein QueC
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 233 aa, Gene n/a, UniProt n/a
>AIK80751.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|queuosine biosynthesis protein QueC
MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDVARELALKLGAVAHKVLDVTLLNELAVSSLTRDNIPVPDYQPDAEGIPNTFVPGRNILFLTLTAIYAYQVKAEAIITGVCETDFSGYPDCRDEFVKALHHAVSLGMAKDIRFETPLMWLNKAETWALADYWGQLDLVRRETLTCYNGIKGDGCGQCAACNLRANGLNQYLADKVGVMAVMQQKTGLAQA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.47 | <1e-323 | ○○○○○ 1 | 0.99800514025122 | 26060277 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)