Bacterial taxon 1308539
Locus VK055_2128
Protein AIK80733.1
rcnR transcriptional repressor
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 81 aa, Gene n/a, UniProt n/a
>AIK80733.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|rcnR transcriptional repressor
MLLTRLKKIQGQSTALEKMLNREQECAEVLQQLAAIRGAVNGMMLQVIQGHLTDHVVKEPDEKQREADLETVMQVIKSYLK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -5.11 | 0.0012 | ●●●○○ -2.53 | -2.5306291631716458 | 26060277 |
Retrieved 1 of 1 entries in 23.4 ms
(Link to these results)