Bacterial taxon 1308539
Locus VK055_1754
Protein AIK80374.1
regulator of acid resistance, influenced by indole
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 88 aa, Gene n/a, UniProt n/a
>AIK80374.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|regulator of acid resistance, influenced by indole
MHQQPDIYARLQDTALSDYFRNAGDKLVDESAVMSLAINSILQSEGHLNNKAIILWLIQALETTDDVVTADVIRKTLEIVVGYTMDDI
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.91 | 0.00013 | ○○○○○ 0.7 | 0.6970301358374402 | 26060277 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)