Bacterial taxon 1308539
Locus VK055_3253
Protein AIK81814.1
regulator of ribonuclease activity A
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 161 aa, Gene n/a, UniProt n/a
>AIK81814.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|regulator of ribonuclease activity A
MKYDTSELCDIYQEDVNVVEPLFSNFGGRSSFGGQIITVKCFEDNGLLYDLLEQNGRGHILLIDGGGSVRRALIDADLARLAVQNEWEGLVVYGAVRQVDDLEELDIGIQALAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGMILSEDPLDIE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -5 | <1e-323 | ●●●○○ -2.48 | -2.4752256008139595 | 26060277 |
Retrieved 1 of 1 entries in 47.4 ms
(Link to these results)