Bacterial taxon 1308539
Locus VK055_4623
Protein AIK83157.1
regulatory protein P-II for glutamine synthetase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 112 aa, Gene n/a, UniProt n/a
>AIK83157.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|regulatory protein P-II for glutamine synthetase
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVTDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.56 | 1.6e-5 | ●○○○○ -0.63 | -0.630783204552317 | 26060277 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)