Bacterial taxon 1308539
Locus VK055_3515
Protein AIK82071.1
rhodanese-like domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 143 aa, Gene n/a, UniProt n/a
>AIK82071.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|rhodanese-like domain protein
MQEIMQFIGRHPVLSIAWIALLGAVVFTTFKGLMSKVKVITRGEATRLINKEDAVVVDLRQRDDFRKGHIAGAINLLPSDIKANNVGELEKHKSQPIIVVDGSGMQAQEPASALNKAGFEKVFVLKEGIAGWSGENLPLVRGK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -8.99 | <1e-323 | ●●●●● -4.61 | -4.611468830795626 | 26060277 |
Retrieved 1 of 1 entries in 2.7 ms
(Link to these results)