Bacterial taxon 1308539
Locus VK055_2115
Protein AIK80720.1
ribosomal protein L31
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 87 aa, Gene n/a, UniProt n/a
>AIK80720.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|ribosomal protein L31
MKAHIHPPYRTVVFHDTSANEYFKVGSTIRTDRVIELDGETFPYVTIDVSSKSHPYYTGKQKTFANEGSAARFRQRFGGFIDAKRKA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.03 | 1.0e-15 | ○○○○○ 0.76 | 0.7609210449941807 | 26060277 |
Retrieved 1 of 1 entries in 18 ms
(Link to these results)