Bacterial taxon 1308539
Locus VK055_3639
Protein AIK82194.1
RNA methyltransferase, RsmD family
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 198 aa, Gene n/a, UniProt n/a
>AIK82194.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|RNA methyltransferase, RsmD family
MKKPNHAGSGQIRIIGGQWRGRKLPVPESPGLRPTTDRVRETLFNWLAPSIVDAHCLDCFAGSGALGLEALSRYAASTTLLEMERGVAQQLQKNLATLKADRGKVITTNTLSFLSQPGTPHQIVFVDPPFRQGLLEETLRLLETQGWLADEALVYVESEVENGLPPVPANWQLYREKVAGQVAYRLYQREAQGEHHAD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.85 | 0.012 | ○○○○○ 1.2 | 1.201970390393118 | 26060277 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)