Bacterial taxon 1308539
Locus VK055_4007
Protein AIK82554.1
short-chain dehydrogenase/reductase family oxidoreductase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 54 aa, Gene n/a, UniProt n/a
>AIK82554.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|short-chain dehydrogenase/reductase family oxidoreductase
MSGGNTVPCNVAPLQNQDKTAAMSIDRREFIPVIRNAYVIRNPERRDGREGKAA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.14 | 0.00022 | ●○○○○ -0.4 | -0.40237000839064746 | 26060277 |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)