Bacterial taxon 1308539
Locus VK055_2611
Protein AIK81205.1
siderophore-iron reductase FhuF
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 262 aa, Gene n/a, UniProt n/a
>AIK81205.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|siderophore-iron reductase FhuF
MAWRSLPLSDELIWRAPLPTAEHALAESIREKIATLRPHLLDFLQLDEPAPRHALTLAEWSQPIALRSLLATWSDHIYRHQPTLPREQKPLLSLWAQWYIGLLVPPLMLALLNEPQGLSLAPEHFHVEFHESGRAACFWIDVHSDADIERLSPQARMDALVTRTLQPVVEALAATGEINSKLIWSNTGYLINWYLGEMRALLGDERLAALRQHCFFEKQLADGQDNPLWRTVMLREGQLVRRTCCQRYRLPDVQQCGDCTLK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.68 | 3.2e-5 | ●○○○○ -0.16 | -0.15631667262808535 | 26060277 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)