Bacterial taxon 1308539
Locus VK055_2916
Protein AIK81503.1
small Multidrug Resistance family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 100 aa, Gene n/a, UniProt n/a
>AIK81503.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|small Multidrug Resistance family protein
MFIAGLLEVVWAVGLKYTHGFSRLVPSVITIVAMVASMALLSWAMKTLPVGTAYAVWTGIGAVGAAVTGIVLLGESASAMRIASLVCIVIGIIGLKISAH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.81 | 5.2e-7 | ●○○○○ -0.76 | -0.7647204480654517 | 26060277 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)