Bacterial taxon 1308539
Locus VK055_3849
Protein AIK82399.1
stringent starvation protein A
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 212 aa, Gene n/a, UniProt n/a
>AIK82399.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|stringent starvation protein A
MAVAANKRSVMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVPTLVDRELTLWESRIIMEYLDERFPHPPLMPVYPVARGESRLYMQRIEKDWYSLMNTIQSGTAAQADAARKQLREELLAIAPVFTQKPYFLSDEFSLVDCYLAPLLWRLPVLGVELVGAGAKELKGYMTRVFERDSFLASLTEAEREMRLGRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.84 | 1.5e-5 | ●○○○○ -0.78 | -0.776035579069185 | 26060277 |
Retrieved 1 of 1 entries in 2.3 ms
(Link to these results)