Bacterial taxon 1308539
Locus VK055_3193
Protein AIK81761.1
thioredoxin
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 109 aa, Gene n/a, UniProt n/a
>AIK81761.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|thioredoxin
MSDKIIHLTDDSFDTDVLKADGLTLVDFWAEWCGPCKMIAPILDEIAEEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.18 | <1e-323 | ●○○○○ -0.96 | -0.9614498859556644 | 26060277 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)