Bacterial taxon 1308539
Locus VK055_3680
Protein AIK82235.1
thiosulfate:cyanide sulfurtransferase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 109 aa, Gene n/a, UniProt n/a
>AIK82235.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|thiosulfate:cyanide sulfurtransferase
MEQFECINVEEAHQKLHQQTAVLVDIRDPQSYAMGHTPGAFHLTNDTLGAFMRDNDFDTAVMVMCYHGNSSKGAAQYLLQQGFDKVYSVDGGFDAWHRHFPAEVARGTF
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.65 | 1.3e-5 | ●●○○○ -1.75 | -1.7479470740762315 | 26060277 |
Retrieved 1 of 1 entries in 10.7 ms
(Link to these results)