Bacterial taxon 1308539
Locus VK055_4049
Protein AIK82596.1
tonB system transport protein ExbD
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 141 aa, Gene n/a, UniProt n/a
>AIK82596.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|tonB system transport protein ExbD
MAMRLNENLDDNGEMHEINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASSSQPQPRPEKPIYLSVKADKSMFLGNDPVTEANMINALDSLTAGKKDTTVFFRADKTVDYETMMKVMDTLHQAGYLKIGLVGEETVKAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.93 | 2.5e-7 | ●●○○○ -1.9 | -1.8982483021875394 | 26060277 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)