Bacterial taxon 1308539
Locus VK055_4460
Protein AIK83004.1
toxin SymE, type I toxin-antitoxin system familyprotein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 102 aa, Gene n/a, UniProt n/a
>AIK83004.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|toxin SymE, type I toxin-antitoxin system familyprotein
MSAQHPTAARGIARAIRQLTVGYVRKRHEDRKTRETRRYTRHAALSLNGDWLEQAGFPVGTQVRVSVSPGKLVIENLELAAPGTGLPSGQSCAGGEPGSPQG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.96 | 8.8e-13 | ●○○○○ -0.84 | -0.8448461919435873 | 26060277 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)