Bacterial taxon 1308539
Locus VK055_2806
Protein AIK81395.1
toxin-antitoxin biofilm protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 150 aa, Gene n/a, UniProt n/a
>AIK81395.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|toxin-antitoxin biofilm protein
MIIGNIHHLQPWLPAALREAIEQVIAQVSEATPLGKHAIDGDNLFYLISEDTTEPQAARRAEYHARYLDIQIVLRGSEGMTFSTLPPGEPQTDWLAEKDIAFLAEGQQEKTVILNEGDFVVFYPGEVHKPLCAVGAPAKVRKAVVKMLMV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.06 | 5.6e-7 | ●○○○○ -0.9 | -0.8986242693553312 | 26060277 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)