Bacterial taxon 1308539
Locus VK055_4550
Protein AIK83088.1
transcriptional regulator family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 142 aa, Gene n/a, UniProt n/a
>AIK83088.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|transcriptional regulator family protein
MAEQMGERSTSAILAYGLEANPSFIRKLMVPLTRDGIIVSTLGRNGSIHLGRPADKITLRDIYLSVIEDKKLWASRPDVPARCVVSANACWYFKSVADEAEQASLNVLARHTVASALEAVKNADTSGCDPVPEMIARFKKAH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.34 | 3.2e-11 | ●●○○○ -1.58 | -1.581858820568302 | 26060277 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)