Bacterial taxon 1308539
Locus VK055_2273
Protein AIK80878.1
transposase family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 173 aa, Gene n/a, UniProt n/a
>AIK80878.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|transposase family protein
MAKPKYSPETKLAVVNHYLSGKDGEQSTADLFGIERTSVRRWVRAWQFHGAEGLTAKNNHYSDEFKLVVVRAVISDRLTMREAAARFNLSAEILVRRWLDVYNDAGAEGLLNMQCGRPGQMTKPKNIPPLTDKELEKLSPEELRAELRYLRAENAYLKKLKALVQSEKNGKKP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.41 | 1.4e-6 | ●●○○○ -1.62 | -1.620500952504127 | 26060277 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)