Bacterial taxon 1308539
Locus VK055_3752
Protein AIK82308.1
type IV leader peptidase family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 161 aa, Gene n/a, UniProt n/a
>AIK82308.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|type IV leader peptidase family protein
MLAALPFLLCYSGLTVALCHQDLRHGLLPDRYTCPLLWSGLLFYLCLAPHQLHDAVWGAIAGYLSLAAIYWLYRGIRGYEGLGYGDIKYLAALGAWHGWRLLPQLVLVASLLAGIAWAGAGLYASCGRKSKWGRSNPLPFGPFLAAAGFWCGWQTLASLTL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.91 | 3.6e-6 | ●○○○○ -0.28 | -0.2785892283318744 | 26060277 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)