Bacterial taxon 1308539
Locus VK055_4180
Protein AIK82725.1
type VII secretion system (T7SS), usher family protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 141 aa, Gene n/a, UniProt n/a
>AIK82725.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|type VII secretion system (T7SS), usher family protein
MGWQGSKGSINVGYGHSHNITGGAIAHSEGQTLSRSLGSSMALVSAPDASGVRLTSGNGVTDWQGFAVAPYLSDYTSNNIGLDPSPLPDNVDLPKTNVEVYPTKGAVVKADFATRIGYLVLMTLTRVGGMGIVPLLRRFRC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -1.5 | 0.0034 | ●○○○○ -0.59 | -0.594106497442043 | 26060277 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)