Bacterial taxon 1308539
Locus VK055_2160
Protein AIK80765.1
ubiquinol oxidase, subunit II
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 264 aa, Gene n/a, UniProt n/a
>AIK80765.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|ubiquinol oxidase, subunit II
MMIVVIPAVLMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIILFLAVLTWKTTHALEPSKPLVHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANVPVHFKVTSNSVMNSFFIPRLGSQIYAMAGMQTQLHLIADEAGTYDGISASYSGPGFSGMKFKAIATPDRATFDQWVAKAKQSPNSMDSMAAFEKVAVPSEYNKVEYFSNVKPDLFKDVVNKFMSHESMNMSKPEGEHAAHDGMEGMDMSHAETAH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.84 | 0.013 | ●○○○○ -0.24 | -0.24401764501732126 | 26060277 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)