Bacterial taxon 1308539
Locus VK055_1881
Protein AIK80487.1
universal stress protein UP12
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 142 aa, Gene n/a, UniProt n/a
>AIK80487.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|universal stress protein UP12
MYKTIIMPVDVFEMALSDKAVRHAEFLAQQDGVIHLLHVLPGSASFTMSRFTADLRRFEEHLQHEAETRLQTMVSHFSIDPSRIKLHVRFGSVRDMVNELASEINADVVVIGSRNPSISTHLLGSNASSVIRHAHIPVMVVR
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.24 | <1e-323 | ○○○○○ 0.87 | 0.8736169345788375 | 26060277 |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)