Bacterial taxon 1308539
Locus VK055_4001
Protein AIK82548.1
urease accessory protein ureF
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 224 aa, Gene n/a, UniProt n/a
>AIK82548.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|urease accessory protein ureF
MSTAEQRLRLMQLASSNLPVGGYSWSQGLEWAVEAGWVPDVAAFERWQRRQMTEGFFTVDLPLFARLYRACEQADIAAAQRWTAYLLACRETRELREEERNRGAAFARLLSDWQPDCPPPWRTLCQQSQLAGMAWLGVRWRIALPEMALSLGYSWIESAVMAGVKLVPFGQQAAQQLILRLCDHYAAEMPRALAAPDGDIGSATPLAAIASARHETQYSRLFRS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 1.46 | 2.2e-16 | ○○○○○ 0.99 | 0.9890518593962552 | 26060277 |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)