Bacterial taxon 1308539
Locus VK055_4176
Protein AIK82721.1
virulence Q domain protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 65 aa, Gene n/a, UniProt n/a
>AIK82721.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|virulence Q domain protein
MFLLMLQFGAKNYFRWSFCLTTITLAFNPAVGSDIFSLAQERVLFTIEGISIAFIMMKIFSYKRS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -5.25 | 0.0077 | ●●●○○ -2.61 | -2.6061057381576265 | 26060277 |
Retrieved 1 of 1 entries in 794.9 ms
(Link to these results)