Bacterial taxon 1308539
Locus VK055_3545
Protein AIK82101.1
ysaB-like lipofamily protein
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 104 aa, Gene n/a, UniProt n/a
>AIK82101.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|ysaB-like lipofamily protein
MEENVVKGVVSVMLVLLLAGCSETVSPPTQKAQRARITPQITLNMAQLCKDQAAIRYNTQTQLVDVNHFEQFQASYELSGRTGKNERFICSFDPDGQFMHLSMR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.62 | 2.9e-6 | ●●○○○ -1.2 | -1.1990905441897195 | 26060277 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)