Bacterial taxon 262316
Locus MAP_0882c
Protein AAS03199.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 304 aa, Gene n/a, UniProt Q742F3
>AAS03199.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MTRSEGDTWNLASSVGATATMVAAARAAATRRPRPVLTDEYAEPLVRAVGLDVFTKLASGELDPDDLERDVGFARMVDTFAARGRFYDDYFAAAGKAGVRQVVIVASGLDARPYRLSWPAGTTVYEIDQPEVIAFKTATLSRIGAAPTAELRTIGIDLRQDWPAALQDAGFDPAQPTAWLAEGVLIGFLPPEAEVRLLDSITPLSAEGSRFAADYGSLNDASQASTEQARRTTEGWRRRGLDMDIAALTYPGKHTDVAAHLGADGWATTTFGLADLFAAAGLPELTEAEQGPAATLSFVRAIKS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 909,059 | 5.74 | 0.039 | ○○○○○ 1.56 | 1.555942522695691 | 24885784 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)